PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009606902.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 615aa    MW: 67727.1 Da    PI: 7.5375
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009606902.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY96.42e-30244301260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     +DgynWrKYGqK v+g+ef+rsYY+Ct+++C +kk+vers+ d+++++++Y g+H+h+k
  XP_009606902.1 244 EDGYNWRKYGQKLVRGNEFTRSYYKCTYPNCLAKKQVERSH-DGHITDVHYIGKHEHPK 301
                     8****************************************.***************85 PP

2WRKY103.21.4e-32420478159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ++Dg++WrKYGqK vkg+++prsYYrC+ agCpvkk+ver+++dpk+v++tYeg+H+h+
  XP_009606902.1 420 VNDGHRWRKYGQKYVKGNPNPRSYYRCSIAGCPVKKHVERASHDPKMVVTTYEGQHDHN 478
                     58********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081121.436238302IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.2E-26240301IPR003657WRKY domain
SuperFamilySSF1182902.35E-24240301IPR003657WRKY domain
SMARTSM007746.3E-34243301IPR003657WRKY domain
PfamPF031064.7E-23244300IPR003657WRKY domain
Gene3DG3DSA:2.20.25.808.2E-34406478IPR003657WRKY domain
SuperFamilySSF1182901.31E-28412479IPR003657WRKY domain
PROSITE profilePS5081133.66415480IPR003657WRKY domain
SMARTSM007744.4E-37420479IPR003657WRKY domain
PfamPF031062.9E-25421477IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 615 aa     Download sequence    Send to blast
MTVVYGPSCT LISPRVPASS RRHRIMGTPR EEATNEVSSE NLQRKPDPDP ATNNPELKEK  60
GRCEPISADV VSGELQKRLS PAADAQASKS NQEETTHPST CQDVSSNVSQ SNQEDISLSK  120
EQQYQSENVR QKQGLKSEGD ASVCSQLSIL PKVSDAKSCG SESGVIEKVV SPLSGKSSDS  180
SDQIQSQSME VVVSQSDHQR VTYPIRPEKT LDKLQPRRNP DTSGHGLPSD RGMTLFRLPE  240
KPLEDGYNWR KYGQKLVRGN EFTRSYYKCT YPNCLAKKQV ERSHDGHITD VHYIGKHEHP  300
KTPSGPQTSP GLVAPLQMRQ PDIPVLTTSE EAEGEKSTTR ETCESSKPSE APLALDIVSA  360
GAGMQVTPLK PHKLENEVDK NSGPDSKRQK KDIAKDDTPP IKSHSEPRHI VQTMSEVDIV  420
NDGHRWRKYG QKYVKGNPNP RSYYRCSIAG CPVKKHVERA SHDPKMVVTT YEGQHDHNMS  480
WFRTLSQITA APDLSLTGIS GESRLESGET KHIGESISEL GENKHVGKSR IESGENKHVG  540
ESRIESGETK RVGQSISESG ETKHVRASIS ESGETKHVGE SRIESGKNKH VGQSRSESGE  600
NKHVNLDMVV HIGAN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A1e-31234479275WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0962980.0AF096298.1 Nicotiana tabacum DNA-binding protein 1 (WRKY1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009606902.10.0PREDICTED: probable WRKY transcription factor 33 isoform X1
TrEMBLQ9ZPL70.0Q9ZPL7_TOBAC; DNA-binding protein 1 (Fragment)
STRINGPGSC0003DMT4000741570.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45582242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.15e-71WRKY family protein